Recombinant Human Caspase-8 (CASP8), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC28332
Artikelname: Recombinant Human Caspase-8 (CASP8), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC28332
Hersteller Artikelnummer: RPC28332
Alternativnummer: BIM-RPC28332-20UG,BIM-RPC28332-100UG,BIM-RPC28332-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Apoptotic cysteine proteaseApoptotic protease Mch-5CAP4FADD-homologous ICE/ced-3-like proteaseFADD-like ICEFLICEICE-like apoptotic protease 5MORT1-associated ced-3 homologMACHCleaved into the following 2 chains:Caspase-8 subunit p18Caspase-8 subunit p10
Recombinant Human Caspase-8 (CASP8), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CASP8. Target Synonyms: Apoptotic cysteine proteaseApoptotic protease Mch-5CAP4FADD-homologous ICE/ced-3-like proteaseFADD-like ICEFLICEICE-like apoptotic protease 5MORT1-associated ced-3 homologMACHCleaved into the following 2 chains:Caspase-8 subunit p18Caspase-8 subunit p10. Accession Number: Q14790. Expression Region: 217-374aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 21.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD
Target-Kategorie: CASP8