Recombinant Human Caspase-8 (CASP8), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC28332
Article Name: Recombinant Human Caspase-8 (CASP8), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC28332
Supplier Catalog Number: RPC28332
Alternative Catalog Number: BIM-RPC28332-20UG,BIM-RPC28332-100UG,BIM-RPC28332-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Apoptotic cysteine proteaseApoptotic protease Mch-5CAP4FADD-homologous ICE/ced-3-like proteaseFADD-like ICEFLICEICE-like apoptotic protease 5MORT1-associated ced-3 homologMACHCleaved into the following 2 chains:Caspase-8 subunit p18Caspase-8 subunit p10
Recombinant Human Caspase-8 (CASP8), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CASP8. Target Synonyms: Apoptotic cysteine proteaseApoptotic protease Mch-5CAP4FADD-homologous ICE/ced-3-like proteaseFADD-like ICEFLICEICE-like apoptotic protease 5MORT1-associated ced-3 homologMACHCleaved into the following 2 chains:Caspase-8 subunit p18Caspase-8 subunit p10. Accession Number: Q14790. Expression Region: 217-374aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 21.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD
Target: CASP8