Recombinant Human Macrophage migration inhibitory factor (MIF), Unconjugated, Yeast

Artikelnummer: BIM-RPC28335
Artikelname: Recombinant Human Macrophage migration inhibitory factor (MIF), Unconjugated, Yeast
Artikelnummer: BIM-RPC28335
Hersteller Artikelnummer: RPC28335
Alternativnummer: BIM-RPC28335-20UG,BIM-RPC28335-100UG,BIM-RPC28335-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Glycosylation-inhibiting factorGIFL-dopachrome isomeraseL-dopachrome tautomerase (EC:5.3.3.12)Phenylpyruvate tautomeraseMIFGLIF, MMIF
Recombinant Human Macrophage migration inhibitory factor (MIF) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MIF. Target Synonyms: Glycosylation-inhibiting factorGIFL-dopachrome isomeraseL-dopachrome tautomerase (EC:5.3.3.12)Phenylpyruvate tautomeraseMIFGLIF, MMIF. Accession Number: P14174. Expression Region: 2~115aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 14.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 14.4kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Target-Kategorie: MIF