Recombinant Human Macrophage migration inhibitory factor (MIF), Unconjugated, Yeast

Catalog Number: BIM-RPC28335
Article Name: Recombinant Human Macrophage migration inhibitory factor (MIF), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC28335
Supplier Catalog Number: RPC28335
Alternative Catalog Number: BIM-RPC28335-20UG,BIM-RPC28335-100UG,BIM-RPC28335-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Glycosylation-inhibiting factorGIFL-dopachrome isomeraseL-dopachrome tautomerase (EC:5.3.3.12)Phenylpyruvate tautomeraseMIFGLIF, MMIF
Recombinant Human Macrophage migration inhibitory factor (MIF) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MIF. Target Synonyms: Glycosylation-inhibiting factorGIFL-dopachrome isomeraseL-dopachrome tautomerase (EC:5.3.3.12)Phenylpyruvate tautomeraseMIFGLIF, MMIF. Accession Number: P14174. Expression Region: 2~115aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 14.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 14.4kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Target: MIF