Recombinant Human Erythropoietin (EPO) , Active Protein, Unconjugated, Mammal

Artikelnummer: BIM-RPC29266
Artikelname: Recombinant Human Erythropoietin (EPO) , Active Protein, Unconjugated, Mammal
Artikelnummer: BIM-RPC29266
Hersteller Artikelnummer: RPC29266
Alternativnummer: BIM-RPC29266-1MG
Hersteller: Biomatik Corporation
Wirt: Mammal
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Erythropoietin, Epoetin, EPO
Accession Number: P01588; EPO. Activity: Biologically Active. Endotoxin Level: ≤10.0 EU/mg, by LAL method. Expiration: 12 months. Expression Region: 28-193aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Human Erythropoietin (EPO) , Active Protein is a purified Active Recombinant Protein
Molekulargewicht: 18.3kDa
Tag: Tag-Free
Reinheit: >95% by SDS-PAGE
Sequenz: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Target-Kategorie: Erythropoietin (EPO)