Recombinant Human Erythropoietin (EPO) , Active Protein, Unconjugated, Mammal

Catalog Number: BIM-RPC29266
Article Name: Recombinant Human Erythropoietin (EPO) , Active Protein, Unconjugated, Mammal
Biozol Catalog Number: BIM-RPC29266
Supplier Catalog Number: RPC29266
Alternative Catalog Number: BIM-RPC29266-1MG
Manufacturer: Biomatik Corporation
Host: Mammal
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Erythropoietin, Epoetin, EPO
Accession Number: P01588; EPO. Activity: Biologically Active. Endotoxin Level: ≤10.0 EU/mg, by LAL method. Expiration: 12 months. Expression Region: 28-193aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Human Erythropoietin (EPO) , Active Protein is a purified Active Recombinant Protein
Molecular Weight: 18.3kDa
Tag: Tag-Free
Purity: >95% by SDS-PAGE
Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Target: Erythropoietin (EPO)