Recombinant Human cytomegalovirus Major capsid protein (MCP), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC29603
Artikelname: Recombinant Human cytomegalovirus Major capsid protein (MCP), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC29603
Hersteller Artikelnummer: RPC29603
Alternativnummer: BIM-RPC29603-20UG,BIM-RPC29603-100UG,BIM-RPC29603-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: MCP
Recombinant Human cytomegalovirus Major capsid protein (MCP), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5). Target Name: cytomegalovirus Major capsid protein (MCP) . Accession Number: P16729, MCP. Expression Region: 1-200aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 27.5kda. Target Synonyms: MCP Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 27.5kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: MENWSALELLPKVGIPTDFLTHVKTSAGEEMFEALRIYYGDDPERYNIHFEAIFGTFCNRLEWVYFLTSGLAAAAHAIKFHDLNKLTTGKMLFHVQVPRVASGAGLPTSRQTTIMVTKYSEKSPITIPFELSAACLTYLRETFEGTILDKILNVEAMHTVLRALKNTADAMERGLIHSFLQTLLRKAPPYFVVQTLVENA
Target-Kategorie: cytomegalovirus Major capsid protein (MCP)