Recombinant Human cytomegalovirus Major capsid protein (MCP), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human cytomegalovirus Major capsid protein (MCP), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29603
• Supplier Catalog Number: RPC29603
• Alternative Catalog Number: BIM-RPC29603-20UG,BIM-RPC29603-100UG,BIM-RPC29603-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Virus
• Conjugation: Unconjugated
• Alternative Names: MCP

Product Description

Recombinant Human cytomegalovirus Major capsid protein (MCP), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5). Target Name: cytomegalovirus Major capsid protein (MCP) . Accession Number: P16729, MCP. Expression Region: 1-200aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 27.5kda. Target Synonyms: MCP Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 27.5kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: MENWSALELLPKVGIPTDFLTHVKTSAGEEMFEALRIYYGDDPERYNIHFEAIFGTFCNRLEWVYFLTSGLAAAAHAIKFHDLNKLTTGKMLFHVQVPRVASGAGLPTSRQTTIMVTKYSEKSPITIPFELSAACLTYLRETFEGTILDKILNVEAMHTVLRALKNTADAMERGLIHSFLQTLLRKAPPYFVVQTLVENA
• Target: cytomegalovirus Major capsid protein (MCP)