Recombinant Human Tryptophan--tRNA ligase, cytoplasmic (WARS1), Unconjugated, Mammal

Artikelnummer: BIM-RPC29752
Artikelname: Recombinant Human Tryptophan--tRNA ligase, cytoplasmic (WARS1), Unconjugated, Mammal
Artikelnummer: BIM-RPC29752
Hersteller Artikelnummer: RPC29752
Alternativnummer: BIM-RPC29752-20UG,BIM-RPC29752-100UG,BIM-RPC29752-1MG
Hersteller: Biomatik Corporation
Wirt: Mammal
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Interferon-induced protein 53, IFP53, Tryptophanyl-tRNA synthetase, TrpRS, hWRS
Accession Number: P23381; WARS1. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 2-471aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Epigenetics, Nuclear Signaling. Shipping Condition: Ice packs. Short Description: Recombinant Human Tryptophan--tRNA ligase, cytoplasmic (WARS1) is a purified Recombinant Protein
Molekulargewicht: 56.7kDa
Tag: N-Terminal 10xHis-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: PNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQ
Target-Kategorie: Tryptophan--tRNA ligase, cytoplasmic (WARS1)