Recombinant Human Tryptophan--tRNA ligase, cytoplasmic (WARS1), Unconjugated, Mammal

Catalog Number: BIM-RPC29752
Article Name: Recombinant Human Tryptophan--tRNA ligase, cytoplasmic (WARS1), Unconjugated, Mammal
Biozol Catalog Number: BIM-RPC29752
Supplier Catalog Number: RPC29752
Alternative Catalog Number: BIM-RPC29752-20UG,BIM-RPC29752-100UG,BIM-RPC29752-1MG
Manufacturer: Biomatik Corporation
Host: Mammal
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Interferon-induced protein 53, IFP53, Tryptophanyl-tRNA synthetase, TrpRS, hWRS
Accession Number: P23381; WARS1. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 2-471aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Epigenetics, Nuclear Signaling. Shipping Condition: Ice packs. Short Description: Recombinant Human Tryptophan--tRNA ligase, cytoplasmic (WARS1) is a purified Recombinant Protein
Molecular Weight: 56.7kDa
Tag: N-Terminal 10xHis-Tagged
Purity: >90% by SDS-PAGE
Sequence: PNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQ
Target: Tryptophan--tRNA ligase, cytoplasmic (WARS1)