Recombinant Human Interleukin-12 subunit beta (IL12B), Unconjugated, Yeast

Produktübersicht

• Artikelname: Recombinant Human Interleukin-12 subunit beta (IL12B), Unconjugated, Yeast
• Artikelnummer: BIM-RPC29755
• Hersteller Artikelnummer: RPC29755
• Alternativnummer: BIM-RPC29755-20UG,BIM-RPC29755-100UG,BIM-RPC29755-1MG
• Hersteller: Biomatik Corporation
• Wirt: Yeast
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: Cytotoxic lymphocyte maturation factor 40 kDa subunit, CLMF p40, IL-12 subunit p40, NK cell stimulatory factor chain 2, NKSF2

Produktbeschreibung

Accession Number: P29460; IL12B. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 23-328aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Immunology. Shipping Condition: Ice packs. Short Description: Recombinant Human Interleukin-12 subunit beta (IL12B) is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 36.8kDa
• Tag: C-Terminal 6xHis-Tagged
• Reinheit: >85% by SDS-PAGE
• Sequenz: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQ
• Target-Kategorie: Interleukin-12 subunit beta (IL12B)