Recombinant Human T cell receptor beta constant 2 (TRBC2), partial, Unconjugated, Yeast

Produktübersicht

• Artikelname: Recombinant Human T cell receptor beta constant 2 (TRBC2), partial, Unconjugated, Yeast
• Artikelnummer: BIM-RPC29756
• Hersteller Artikelnummer: RPC29756
• Alternativnummer: BIM-RPC29756-20UG,BIM-RPC29756-100UG,BIM-RPC29756-1MG
• Hersteller: Biomatik Corporation
• Wirt: Yeast
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: TCRBC2

Produktbeschreibung

Accession Number: A0A5B9; TRBC2. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-129aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Human T cell receptor beta constant 2 (TRBC2), partial is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 16.2kDa
• Tag: C-Terminal 6xHis-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
• Target-Kategorie: T cell receptor beta constant 2 (TRBC2)