Recombinant Human T cell receptor beta constant 2 (TRBC2), partial, Unconjugated, Yeast

Catalog Number: BIM-RPC29756
Article Name: Recombinant Human T cell receptor beta constant 2 (TRBC2), partial, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC29756
Supplier Catalog Number: RPC29756
Alternative Catalog Number: BIM-RPC29756-20UG,BIM-RPC29756-100UG,BIM-RPC29756-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: TCRBC2
Accession Number: A0A5B9; TRBC2. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-129aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Human T cell receptor beta constant 2 (TRBC2), partial is a purified Recombinant Protein
Molecular Weight: 16.2kDa
Tag: C-Terminal 6xHis-Tagged
Purity: >90% by SDS-PAGE
Sequence: DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Target: T cell receptor beta constant 2 (TRBC2)