Recombinant Mouse Complement receptor type 2 (Cr2), partial, Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Mouse Complement receptor type 2 (Cr2), partial, Unconjugated, E. coli
• Artikelnummer: BIM-RPC29760
• Hersteller Artikelnummer: RPC29760
• Alternativnummer: BIM-RPC29760-20UG,BIM-RPC29760-100UG,BIM-RPC29760-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Mouse
• Konjugation: Unconjugated
• Alternative Synonym: Complement C3d receptor, CD_antigen: CD21

Produktbeschreibung

Accession Number: P19070; Cr2. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 12-145aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Immunology. Shipping Condition: Ice packs. Short Description: Recombinant Mouse Complement receptor type 2 (Cr2), partial is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 18.7kDa
• Tag: N-Terminal 6xHis-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE
• Target-Kategorie: Complement receptor type 2 (Cr2)