Recombinant Influenza A virus Matrix protein 2 (M), Unconjugated

Artikelnummer: BIM-RPC29762
Artikelname: Recombinant Influenza A virus Matrix protein 2 (M), Unconjugated
Artikelnummer: BIM-RPC29762
Hersteller Artikelnummer: RPC29762
Alternativnummer: BIM-RPC29762-20UG,BIM-RPC29762-100UG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Proton channel protein M2
Accession Number: A4GCM0; M. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-97aa. Protein Length: Full Length. Protein Type: CF Transmembrane Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Influenza A virus Matrix protein 2 (M) is a purified CF Transmembrane Protein. Host Notes: in vitro E. coli expression system
Molekulargewicht: 17.2kDa
Tag: N-Terminal 10xHis-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLKRGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE
Target-Kategorie: Matrix protein 2 (M)