Recombinant Rat Apolipoprotein E (Apoe), Unconjugated, E. coli

Artikelnummer: BIM-RPC29768
Artikelname: Recombinant Rat Apolipoprotein E (Apoe), Unconjugated, E. coli
Artikelnummer: BIM-RPC29768
Hersteller Artikelnummer: RPC29768
Alternativnummer: BIM-RPC29768-20UG,BIM-RPC29768-100UG,BIM-RPC29768-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Konjugation: Unconjugated
Alternative Synonym: Apo-E
Accession Number: P02650; Apoe. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 19-312aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Rat Apolipoprotein E (Apoe) is a purified Recombinant Protein
Molekulargewicht: 39.8kDa
Tag: N-Terminal 6xHis-Tagged
Reinheit: >85% by SDS-PAGE
Sequenz: EGELEVTDQLPGQSDQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTVLMEDTMTEVKAYKKELEEQLGPVAEETRARLAKEVQAAQARLGADMEDLRNRLGQYRNEVNTMLGQSTEELRSRLSTHLRKMRKRLMRDADDLQKRLAVYKAGAQEGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQALSDRIRGRLEEVGNQARDRLEEVREQMEEVRSKMEEQTQQIRLQAEIFQARIK
Target-Kategorie: Apolipoprotein E (Apoe)