Recombinant Rat Apolipoprotein E (Apoe), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Rat Apolipoprotein E (Apoe), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29768
• Supplier Catalog Number: RPC29768
• Alternative Catalog Number: BIM-RPC29768-20UG,BIM-RPC29768-100UG,BIM-RPC29768-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Rat
• Conjugation: Unconjugated
• Alternative Names: Apo-E

Product Description

Accession Number: P02650; Apoe. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 19-312aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Rat Apolipoprotein E (Apoe) is a purified Recombinant Protein

Product Properties

• Molecular Weight: 39.8kDa
• Tag: N-Terminal 6xHis-Tagged
• Purity: >85% by SDS-PAGE
• Sequence: EGELEVTDQLPGQSDQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTVLMEDTMTEVKAYKKELEEQLGPVAEETRARLAKEVQAAQARLGADMEDLRNRLGQYRNEVNTMLGQSTEELRSRLSTHLRKMRKRLMRDADDLQKRLAVYKAGAQEGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQALSDRIRGRLEEVGNQARDRLEEVREQMEEVRSKMEEQTQQIRLQAEIFQARIK
• Target: Apolipoprotein E (Apoe)