Recombinant Vaccinia virus RNA-binding protein OPG065 (OPG065), Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Vaccinia virus RNA-binding protein OPG065 (OPG065), Unconjugated, E. coli
• Artikelnummer: BIM-RPC29793
• Hersteller Artikelnummer: RPC29793
• Alternativnummer: BIM-RPC29793-20UG,BIM-RPC29793-100UG,BIM-RPC29793-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Virus
• Konjugation: Unconjugated
• Alternative Synonym: p25

Produktbeschreibung

Accession Number: P21081; OPG065. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-190aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Vaccinia virus RNA-binding protein OPG065 (OPG065) is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 28.5kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Reinheit: >85% by SDS-PAGE
• Sequenz: MSKIYIDERSDAEIVCAAIKNIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTTEADKPDADAMADVIIDDVSREKSMREDHKSFDDVIPAKKIIDWKDANPVTIINEYCQITKRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVDKLLGYVIIRF
• Target-Kategorie: RNA-binding protein OPG065 (OPG065)