Recombinant Vaccinia virus RNA-binding protein OPG065 (OPG065), Unconjugated, E. coli

Catalog Number: BIM-RPC29793
Article Name: Recombinant Vaccinia virus RNA-binding protein OPG065 (OPG065), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC29793
Supplier Catalog Number: RPC29793
Alternative Catalog Number: BIM-RPC29793-20UG,BIM-RPC29793-100UG,BIM-RPC29793-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: p25
Accession Number: P21081; OPG065. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-190aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Vaccinia virus RNA-binding protein OPG065 (OPG065) is a purified Recombinant Protein
Molecular Weight: 28.5kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >85% by SDS-PAGE
Sequence: MSKIYIDERSDAEIVCAAIKNIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTTEADKPDADAMADVIIDDVSREKSMREDHKSFDDVIPAKKIIDWKDANPVTIINEYCQITKRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVDKLLGYVIIRF
Target: RNA-binding protein OPG065 (OPG065)