Recombinant Staphylococcus aureus Staphylococcal complement inhibitor (scn), Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Staphylococcus aureus Staphylococcal complement inhibitor (scn), Unconjugated, E. coli
• Artikelnummer: BIM-RPC29794
• Hersteller Artikelnummer: RPC29794
• Alternativnummer: BIM-RPC29794-20UG,BIM-RPC29794-100UG,BIM-RPC29794-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Bacteria
• Konjugation: Unconjugated
• Alternative Synonym: SCIN

Produktbeschreibung

Accession Number: A7X482; scn. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 32-116aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Staphylococcus aureus Staphylococcal complement inhibitor (scn) is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 17.2kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY
• Target-Kategorie: Staphylococcal complement inhibitor (scn)