Recombinant Staphylococcus aureus Staphylococcal complement inhibitor (scn), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Staphylococcus aureus Staphylococcal complement inhibitor (scn), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29794
• Supplier Catalog Number: RPC29794
• Alternative Catalog Number: BIM-RPC29794-20UG,BIM-RPC29794-100UG,BIM-RPC29794-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Bacteria
• Conjugation: Unconjugated
• Alternative Names: SCIN

Product Description

Accession Number: A7X482; scn. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 32-116aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Staphylococcus aureus Staphylococcal complement inhibitor (scn) is a purified Recombinant Protein

Product Properties

• Molecular Weight: 17.2kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY
• Target: Staphylococcal complement inhibitor (scn)