Recombinant Human Intestinal-type alkaline phosphatase (ALPI) , Active Protein, Unconjugated, Mammal

Artikelnummer: BIM-RPC29796
Artikelname: Recombinant Human Intestinal-type alkaline phosphatase (ALPI) , Active Protein, Unconjugated, Mammal
Artikelnummer: BIM-RPC29796
Hersteller Artikelnummer: RPC29796
Alternativnummer: BIM-RPC29796-20UG,BIM-RPC29796-100UG,BIM-RPC29796-1MG
Hersteller: Biomatik Corporation
Wirt: Mammal
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: IAP, Intestinal alkaline phosphatase
Accession Number: P09923; ALPI. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 20-503aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Signal Transduction. Shipping Condition: Ice packs. Short Description: Recombinant Human Intestinal-type alkaline phosphatase (ALPI) , Active Protein is a purified Active Recombinant Protein
Molekulargewicht: 55.2kDa
Tag: N-Terminal 10xHis-Tagged
Reinheit: >95% by SDS-PAGE
Sequenz: VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELM
Target-Kategorie: Intestinal-type alkaline phosphatase (ALPI)