Recombinant Human Intestinal-type alkaline phosphatase (ALPI) , Active Protein, Unconjugated, Mammal

Product Overview

• Article Name: Recombinant Human Intestinal-type alkaline phosphatase (ALPI) , Active Protein, Unconjugated, Mammal
• Biozol Catalog Number: BIM-RPC29796
• Supplier Catalog Number: RPC29796
• Alternative Catalog Number: BIM-RPC29796-20UG,BIM-RPC29796-100UG,BIM-RPC29796-1MG
• Manufacturer: Biomatik Corporation
• Host: Mammal
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: IAP, Intestinal alkaline phosphatase

Product Description

Accession Number: P09923; ALPI. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 20-503aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Signal Transduction. Shipping Condition: Ice packs. Short Description: Recombinant Human Intestinal-type alkaline phosphatase (ALPI) , Active Protein is a purified Active Recombinant Protein

Product Properties

• Molecular Weight: 55.2kDa
• Tag: N-Terminal 10xHis-Tagged
• Purity: >95% by SDS-PAGE
• Sequence: VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELM
• Target: Intestinal-type alkaline phosphatase (ALPI)