Recombinant Human Zymogen granule protein 16 homolog B (ZG16B) , Active Protein, Unconjugated, Mammal

Artikelnummer: BIM-RPC29798
Artikelname: Recombinant Human Zymogen granule protein 16 homolog B (ZG16B) , Active Protein, Unconjugated, Mammal
Artikelnummer: BIM-RPC29798
Hersteller Artikelnummer: RPC29798
Alternativnummer: BIM-RPC29798-20UG,BIM-RPC29798-100UG,BIM-RPC29798-1MG
Hersteller: Biomatik Corporation
Wirt: Mammal
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Accession Number: Q96DA0; ZG16B. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 53-208aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Zymogen granule protein 16 homolog B (ZG16B) , Active Protein is a purified Active Recombinant Protein
Molekulargewicht: 20.0kDa
Tag: C-Terminal 10xHis-Tagged
Reinheit: >95% by SDS-PAGE
Sequenz: GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Target-Kategorie: Zymogen granule protein 16 homolog B (ZG16B)