Recombinant Human Zymogen granule protein 16 homolog B (ZG16B) , Active Protein, Unconjugated, Mammal

Catalog Number: BIM-RPC29798
Article Name: Recombinant Human Zymogen granule protein 16 homolog B (ZG16B) , Active Protein, Unconjugated, Mammal
Biozol Catalog Number: BIM-RPC29798
Supplier Catalog Number: RPC29798
Alternative Catalog Number: BIM-RPC29798-20UG,BIM-RPC29798-100UG,BIM-RPC29798-1MG
Manufacturer: Biomatik Corporation
Host: Mammal
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Accession Number: Q96DA0; ZG16B. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 53-208aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Zymogen granule protein 16 homolog B (ZG16B) , Active Protein is a purified Active Recombinant Protein
Molecular Weight: 20.0kDa
Tag: C-Terminal 10xHis-Tagged
Purity: >95% by SDS-PAGE
Sequence: GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Target: Zymogen granule protein 16 homolog B (ZG16B)