Recombinant Human Transcriptional enhancer factor TEF-1 (TEAD1), Unconjugated, Yeast

Artikelnummer: BIM-RPC29799
Artikelname: Recombinant Human Transcriptional enhancer factor TEF-1 (TEAD1), Unconjugated, Yeast
Artikelnummer: BIM-RPC29799
Hersteller Artikelnummer: RPC29799
Alternativnummer: BIM-RPC29799-20UG,BIM-RPC29799-100UG,BIM-RPC29799-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: NTEF-1, Protein GT-IIC, TEA domain family member 1, TEAD-1, Transcription factor 13, TCF-13
Accession Number: P28347; TEAD1. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-426aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Human Transcriptional enhancer factor TEF-1 (TEAD1) is a purified Recombinant Protein
Molekulargewicht: 73.4kDa
Tag: C-Terminal GST-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDFHSKLKDQTAKDKALQHMAAMSSAQIVSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLL
Target-Kategorie: Transcriptional enhancer factor TEF-1 (TEAD1)