Recombinant Human Transcriptional enhancer factor TEF-1 (TEAD1), Unconjugated, Yeast

Product Overview

• Article Name: Recombinant Human Transcriptional enhancer factor TEF-1 (TEAD1), Unconjugated, Yeast
• Biozol Catalog Number: BIM-RPC29799
• Supplier Catalog Number: RPC29799
• Alternative Catalog Number: BIM-RPC29799-20UG,BIM-RPC29799-100UG,BIM-RPC29799-1MG
• Manufacturer: Biomatik Corporation
• Host: Yeast
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: NTEF-1, Protein GT-IIC, TEA domain family member 1, TEAD-1, Transcription factor 13, TCF-13

Product Description

Accession Number: P28347; TEAD1. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-426aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Human Transcriptional enhancer factor TEF-1 (TEAD1) is a purified Recombinant Protein

Product Properties

• Molecular Weight: 73.4kDa
• Tag: C-Terminal GST-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDFHSKLKDQTAKDKALQHMAAMSSAQIVSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLL
• Target: Transcriptional enhancer factor TEF-1 (TEAD1)