Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1), Unconjugated, E. coli

Artikelnummer: BIM-RPC29805
Artikelname: Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1), Unconjugated, E. coli
Artikelnummer: BIM-RPC29805
Hersteller Artikelnummer: RPC29805
Alternativnummer: BIM-RPC29805-20UG,BIM-RPC29805-100UG,BIM-RPC29805-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Accession Number: P00492; HPRT1. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 2-218aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Metabolism. Shipping Condition: Ice packs. Short Description: Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1) is a purified Recombinant Protein
Molekulargewicht: 28.4kDa
Tag: N-Terminal 6xHis-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Target-Kategorie: Hypoxanthine-guanine phosphoribosyltransferase (HPRT1)