Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1), Unconjugated, E. coli

Catalog Number: BIM-RPC29805
Article Name: Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC29805
Supplier Catalog Number: RPC29805
Alternative Catalog Number: BIM-RPC29805-20UG,BIM-RPC29805-100UG,BIM-RPC29805-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Accession Number: P00492; HPRT1. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 2-218aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Metabolism. Shipping Condition: Ice packs. Short Description: Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1) is a purified Recombinant Protein
Molecular Weight: 28.4kDa
Tag: N-Terminal 6xHis-Tagged
Purity: >90% by SDS-PAGE
Sequence: ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Target: Hypoxanthine-guanine phosphoribosyltransferase (HPRT1)