Recombinant Clostridium botulinum Hemagglutinin component of the neurotoxin complex (ha17), Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Clostridium botulinum Hemagglutinin component of the neurotoxin complex (ha17), Unconjugated, E. coli
• Artikelnummer: BIM-RPC29902
• Hersteller Artikelnummer: RPC29902
• Alternativnummer: BIM-RPC29902-20UG,BIM-RPC29902-100UG,BIM-RPC29902-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Bacteria
• Konjugation: Unconjugated

Produktbeschreibung

Recombinant Clostridium botulinum Hemagglutinin component of the neurotoxin complex (ha17) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Clostridium botulinum. Target Name: Hemagglutinin component of the neurotoxin complex (ha17) . Accession Number: A5HZZ5, ha17. Expression Region: 2-146aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 24.3kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Produkteigenschaften

• Molekulargewicht: 24.3kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: SVERTFLPNGNYNIKSIFSGSLYLNPVSKSLTFSNESSANNQKWNVEYMAENRCFKISNVAEPNKYLSYDNFGFISLDSLSNRCYWFPIKIAVNTYIMLSLNKVNELDYAWDIYDTNENILSQPLLLLPNFDIYNSNQMFKLEKI
• Target-Kategorie: Hemagglutinin component of the neurotoxin complex (ha17)