Recombinant Clostridium botulinum Hemagglutinin component of the neurotoxin complex (ha17), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Clostridium botulinum Hemagglutinin component of the neurotoxin complex (ha17), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29902
• Supplier Catalog Number: RPC29902
• Alternative Catalog Number: BIM-RPC29902-20UG,BIM-RPC29902-100UG,BIM-RPC29902-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Bacteria
• Conjugation: Unconjugated

Product Description

Recombinant Clostridium botulinum Hemagglutinin component of the neurotoxin complex (ha17) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Clostridium botulinum. Target Name: Hemagglutinin component of the neurotoxin complex (ha17) . Accession Number: A5HZZ5, ha17. Expression Region: 2-146aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 24.3kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 24.3kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: SVERTFLPNGNYNIKSIFSGSLYLNPVSKSLTFSNESSANNQKWNVEYMAENRCFKISNVAEPNKYLSYDNFGFISLDSLSNRCYWFPIKIAVNTYIMLSLNKVNELDYAWDIYDTNENILSQPLLLLPNFDIYNSNQMFKLEKI
• Target: Hemagglutinin component of the neurotoxin complex (ha17)