Recombinant Human GTP:AMP phosphotransferase, mitochondrial (AK3), Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Human GTP:AMP phosphotransferase, mitochondrial (AK3), Unconjugated, E. coli
• Artikelnummer: BIM-RPC29932
• Hersteller Artikelnummer: RPC29932
• Alternativnummer: BIM-RPC29932-20UG,BIM-RPC29932-100UG,BIM-RPC29932-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: Adenylate kinase 3, AK 3, Adenylate kinase 3 alpha-like 1, AK3L1, AK6, AKL3L

Produktbeschreibung

Recombinant Human GTP:AMP phosphotransferase, mitochondrial (AK3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GTP:AMP phosphotransferase, mitochondrial (AK3) . Accession Number: Q9UIJ7, AK3. Expression Region: 1-227aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 32.6kda. Target Synonyms: Adenylate kinase 3, AK 3, Adenylate kinase 3 alpha-like 1, AK3L1, AK6, AKL3L Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Produkteigenschaften

• Molekulargewicht: 32.6kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
• Target-Kategorie: GTP:AMP phosphotransferase, mitochondrial (AK3)