Recombinant Human GTP:AMP phosphotransferase, mitochondrial (AK3), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human GTP:AMP phosphotransferase, mitochondrial (AK3), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29932
• Supplier Catalog Number: RPC29932
• Alternative Catalog Number: BIM-RPC29932-20UG,BIM-RPC29932-100UG,BIM-RPC29932-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Adenylate kinase 3, AK 3, Adenylate kinase 3 alpha-like 1, AK3L1, AK6, AKL3L

Product Description

Recombinant Human GTP:AMP phosphotransferase, mitochondrial (AK3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GTP:AMP phosphotransferase, mitochondrial (AK3) . Accession Number: Q9UIJ7, AK3. Expression Region: 1-227aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 32.6kda. Target Synonyms: Adenylate kinase 3, AK 3, Adenylate kinase 3 alpha-like 1, AK3L1, AK6, AKL3L Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 32.6kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
• Target: GTP:AMP phosphotransferase, mitochondrial (AK3)