Recombinant Human Cathepsin O (CTSO), Unconjugated, Mammal

Produktübersicht

• Artikelname: Recombinant Human Cathepsin O (CTSO), Unconjugated, Mammal
• Artikelnummer: BIM-RPC29941
• Hersteller Artikelnummer: RPC29941
• Alternativnummer: BIM-RPC29941-20UG,BIM-RPC29941-100UG,BIM-RPC29941-1MG
• Hersteller: Biomatik Corporation
• Wirt: Mammal
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: CTSO1

Produktbeschreibung

Recombinant Human Cathepsin O (CTSO) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Cathepsin O (CTSO) . Accession Number: P43234, CTSO. Expression Region: 108-321aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 28.5kda. Target Synonyms: CTSO1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Produkteigenschaften

• Molekulargewicht: 28.5kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Reinheit: >85% by SDS-PAGE
• Sequenz: LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV
• Target-Kategorie: Cathepsin O (CTSO)