Recombinant Human Cathepsin O (CTSO), Unconjugated, Mammal

Product Overview

• Article Name: Recombinant Human Cathepsin O (CTSO), Unconjugated, Mammal
• Biozol Catalog Number: BIM-RPC29941
• Supplier Catalog Number: RPC29941
• Alternative Catalog Number: BIM-RPC29941-20UG,BIM-RPC29941-100UG,BIM-RPC29941-1MG
• Manufacturer: Biomatik Corporation
• Host: Mammal
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: CTSO1

Product Description

Recombinant Human Cathepsin O (CTSO) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Cathepsin O (CTSO) . Accession Number: P43234, CTSO. Expression Region: 108-321aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 28.5kda. Target Synonyms: CTSO1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 28.5kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >85% by SDS-PAGE
• Sequence: LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV
• Target: Cathepsin O (CTSO)