Recombinant Human D-dopachrome decarboxylase-like protein (DDTL), Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Human D-dopachrome decarboxylase-like protein (DDTL), Unconjugated, E. coli
• Artikelnummer: BIM-RPC29958
• Hersteller Artikelnummer: RPC29958
• Alternativnummer: BIM-RPC29958-20UG,BIM-RPC29958-100UG,BIM-RPC29958-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: D-dopachrome tautomerase-like protein

Produktbeschreibung

Recombinant Human D-dopachrome decarboxylase-like protein (DDTL) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: D-dopachrome decarboxylase-like protein (DDTL) . Accession Number: A6NHG4, DDTL. Expression Region: 1-134aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 21.6kda. Target Synonyms: D-dopachrome tautomerase-like protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Produkteigenschaften

• Molekulargewicht: 21.6kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRFPTVLSTSPAAHGGPRCPGEIIEGKKSCLNEEALFIYFI
• Target-Kategorie: D-dopachrome decarboxylase-like protein (DDTL)