Recombinant Human D-dopachrome decarboxylase-like protein (DDTL), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human D-dopachrome decarboxylase-like protein (DDTL), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29958
• Supplier Catalog Number: RPC29958
• Alternative Catalog Number: BIM-RPC29958-20UG,BIM-RPC29958-100UG,BIM-RPC29958-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: D-dopachrome tautomerase-like protein

Product Description

Recombinant Human D-dopachrome decarboxylase-like protein (DDTL) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: D-dopachrome decarboxylase-like protein (DDTL) . Accession Number: A6NHG4, DDTL. Expression Region: 1-134aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 21.6kda. Target Synonyms: D-dopachrome tautomerase-like protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 21.6kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRFPTVLSTSPAAHGGPRCPGEIIEGKKSCLNEEALFIYFI
• Target: D-dopachrome decarboxylase-like protein (DDTL)