Recombinant Mouse Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 (Gng12), Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Mouse Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 (Gng12), Unconjugated, E. coli
• Artikelnummer: BIM-RPC30526
• Hersteller Artikelnummer: RPC30526
• Alternativnummer: BIM-RPC30526-20UG,BIM-RPC30526-100UG,BIM-RPC30526-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Mouse
• Konjugation: Unconjugated
• Alternative Synonym: Guanine nucleotide-binding protein G(I) /G(S) /G(O) subunit gamma-12

Produktbeschreibung

Accession Number: Q9DAS9; Gng12. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 2-69aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Mouse Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 (Gng12) is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 15.0kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: SSKTASTNSIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLMGIPTSENPFKDKKTC
• Target-Kategorie: Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 (Gng12)