Recombinant Mouse Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 (Gng12), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Mouse Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 (Gng12), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC30526
• Supplier Catalog Number: RPC30526
• Alternative Catalog Number: BIM-RPC30526-20UG,BIM-RPC30526-100UG,BIM-RPC30526-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Conjugation: Unconjugated
• Alternative Names: Guanine nucleotide-binding protein G(I) /G(S) /G(O) subunit gamma-12

Product Description

Accession Number: Q9DAS9; Gng12. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 2-69aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Mouse Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 (Gng12) is a purified Recombinant Protein

Product Properties

• Molecular Weight: 15.0kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: SSKTASTNSIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLMGIPTSENPFKDKKTC
• Target: Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 (Gng12)