Recombinant Human Enhancer of yellow 2 transcription factor homolog (ENY2), Unconjugated, E. coli

Artikelnummer: BIM-RPC30536
Artikelname: Recombinant Human Enhancer of yellow 2 transcription factor homolog (ENY2), Unconjugated, E. coli
Artikelnummer: BIM-RPC30536
Hersteller Artikelnummer: RPC30536
Alternativnummer: BIM-RPC30536-20UG,BIM-RPC30536-100UG,BIM-RPC30536-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Enhancer of yellow 2 transcription factor homolog
Accession Number: Q9NPA8; ENY2. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-101aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cell Biology. Shipping Condition: Ice packs. Short Description: Recombinant Human Enhancer of yellow 2 transcription factor homolog (ENY2) is a purified Recombinant Protein
Molekulargewicht: 18.4kDa
Tag: C-Terminal 6xHis-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL
Target-Kategorie: Enhancer of yellow 2 transcription factor homolog (ENY2)