Recombinant Human Enhancer of yellow 2 transcription factor homolog (ENY2), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human Enhancer of yellow 2 transcription factor homolog (ENY2), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC30536
• Supplier Catalog Number: RPC30536
• Alternative Catalog Number: BIM-RPC30536-20UG,BIM-RPC30536-100UG,BIM-RPC30536-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Enhancer of yellow 2 transcription factor homolog

Product Description

Accession Number: Q9NPA8; ENY2. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-101aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cell Biology. Shipping Condition: Ice packs. Short Description: Recombinant Human Enhancer of yellow 2 transcription factor homolog (ENY2) is a purified Recombinant Protein

Product Properties

• Molecular Weight: 18.4kDa
• Tag: C-Terminal 6xHis-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL
• Target: Enhancer of yellow 2 transcription factor homolog (ENY2)