Recombinant Human Alpha-2A adrenergic receptor (ADRA2A) -VLPs, Unconjugated, Mammal

Produktübersicht

• Artikelname: Recombinant Human Alpha-2A adrenergic receptor (ADRA2A) -VLPs, Unconjugated, Mammal
• Artikelnummer: BIM-RPC30539
• Hersteller Artikelnummer: RPC30539
• Alternativnummer: BIM-RPC30539-20UG,BIM-RPC30539-100UG,BIM-RPC30539-1MG
• Hersteller: Biomatik Corporation
• Wirt: Mammal
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: Alpha-2 adrenergic receptor subtype C10, Alpha-2A adrenoreceptor, Alpha-2A adrenoceptor, Alpha-2AAR

Produktbeschreibung

Accession Number: P08913; ADRA2A. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-465aa. Protein Length: Full Length. Protein Type: MP-VLP Transmembrane Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Neuroscience. Shipping Condition: Ice packs. Short Description: Recombinant Human Alpha-2A adrenergic receptor (ADRA2A) -VLPs is a purified MP-VLP Transmembrane Protein

Produkteigenschaften

• Molekulargewicht: 52.0kDa
• Tag: C-Terminal 10xHis-Tagged (This tag can be tested only under denaturing conditions)
• Reinheit: The purity information is not available for VLPs proteins
• Sequenz: MFRQEQPLAEGSFAPMGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAV
• Target-Kategorie: Alpha-2A adrenergic receptor (ADRA2A) -VLPs