Recombinant Human Alpha-2A adrenergic receptor (ADRA2A) -VLPs, Unconjugated, Mammal

Product Overview

• Article Name: Recombinant Human Alpha-2A adrenergic receptor (ADRA2A) -VLPs, Unconjugated, Mammal
• Biozol Catalog Number: BIM-RPC30539
• Supplier Catalog Number: RPC30539
• Alternative Catalog Number: BIM-RPC30539-20UG,BIM-RPC30539-100UG,BIM-RPC30539-1MG
• Manufacturer: Biomatik Corporation
• Host: Mammal
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Alpha-2 adrenergic receptor subtype C10, Alpha-2A adrenoreceptor, Alpha-2A adrenoceptor, Alpha-2AAR

Product Description

Accession Number: P08913; ADRA2A. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-465aa. Protein Length: Full Length. Protein Type: MP-VLP Transmembrane Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Neuroscience. Shipping Condition: Ice packs. Short Description: Recombinant Human Alpha-2A adrenergic receptor (ADRA2A) -VLPs is a purified MP-VLP Transmembrane Protein

Product Properties

• Molecular Weight: 52.0kDa
• Tag: C-Terminal 10xHis-Tagged (This tag can be tested only under denaturing conditions)
• Purity: The purity information is not available for VLPs proteins
• Sequence: MFRQEQPLAEGSFAPMGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAV
• Target: Alpha-2A adrenergic receptor (ADRA2A) -VLPs