Recombinant Rat Intestinal-type alkaline phosphatase 1 (Alpi) , Active Protein, Unconjugated, Mammal

Artikelnummer: BIM-RPC30540
Artikelname: Recombinant Rat Intestinal-type alkaline phosphatase 1 (Alpi) , Active Protein, Unconjugated, Mammal
Artikelnummer: BIM-RPC30540
Hersteller Artikelnummer: RPC30540
Alternativnummer: BIM-RPC30540-20UG,BIM-RPC30540-100UG,BIM-RPC30540-1MG
Hersteller: Biomatik Corporation
Wirt: Mammal
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Konjugation: Unconjugated
Alternative Synonym: IAP-1, Intestinal alkaline phosphatase 1, Intestinal alkaline phosphatase I, IAP-I
Accession Number: P15693; Alpi. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 21-511aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Signal Transduction. Shipping Condition: Ice packs. Short Description: Recombinant Rat Intestinal-type alkaline phosphatase 1 (Alpi) , Active Protein is a purified Active Recombinant Protein
Molekulargewicht: 55.9kDa
Tag: N-Terminal 10xHis-Tagged
Reinheit: >95% by SDS-PAGE
Sequenz: VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLM
Target-Kategorie: Intestinal-type alkaline phosphatase 1 (Alpi)