Recombinant Rat Intestinal-type alkaline phosphatase 1 (Alpi) , Active Protein, Unconjugated, Mammal

Catalog Number: BIM-RPC30540
Article Name: Recombinant Rat Intestinal-type alkaline phosphatase 1 (Alpi) , Active Protein, Unconjugated, Mammal
Biozol Catalog Number: BIM-RPC30540
Supplier Catalog Number: RPC30540
Alternative Catalog Number: BIM-RPC30540-20UG,BIM-RPC30540-100UG,BIM-RPC30540-1MG
Manufacturer: Biomatik Corporation
Host: Mammal
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: IAP-1, Intestinal alkaline phosphatase 1, Intestinal alkaline phosphatase I, IAP-I
Accession Number: P15693; Alpi. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 21-511aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Signal Transduction. Shipping Condition: Ice packs. Short Description: Recombinant Rat Intestinal-type alkaline phosphatase 1 (Alpi) , Active Protein is a purified Active Recombinant Protein
Molecular Weight: 55.9kDa
Tag: N-Terminal 10xHis-Tagged
Purity: >95% by SDS-PAGE
Sequence: VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLM
Target: Intestinal-type alkaline phosphatase 1 (Alpi)