Recombinant Human Chondroitin sulfate proteoglycan 4 (CSPG4), partial, Unconjugated, Mammal

Produktübersicht

• Artikelname: Recombinant Human Chondroitin sulfate proteoglycan 4 (CSPG4), partial, Unconjugated, Mammal
• Artikelnummer: BIM-RPC30545
• Hersteller Artikelnummer: RPC30545
• Alternativnummer: BIM-RPC30545-20UG,BIM-RPC30545-100UG,BIM-RPC30545-1MG
• Hersteller: Biomatik Corporation
• Wirt: Mammal
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: Chondroitin sulfate proteoglycan NG2, Melanoma chondroitin sulfate proteoglycan, Melanoma-associated chondroitin sulfate proteoglycan, MCSP

Produktbeschreibung

Accession Number: Q6UVK1; CSPG4. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1583-2224aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Chondroitin sulfate proteoglycan 4 (CSPG4), partial is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 73.2kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Reinheit: >85% by SDS-PAGE
• Sequenz: SLKGSQTLTVCPGSVQPLSSQTLRASSSAGTDPQLLLYRVVRGPQLGRLFHAQQDSTGEALVNFTQAEVYAGNILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHLQGPAGASVAGPQTSEAFAITVRDVNERPPQPQ
• Target-Kategorie: Chondroitin sulfate proteoglycan 4 (CSPG4)