Recombinant Human Chondroitin sulfate proteoglycan 4 (CSPG4), partial, Unconjugated, Mammal

Product Overview

• Article Name: Recombinant Human Chondroitin sulfate proteoglycan 4 (CSPG4), partial, Unconjugated, Mammal
• Biozol Catalog Number: BIM-RPC30545
• Supplier Catalog Number: RPC30545
• Alternative Catalog Number: BIM-RPC30545-20UG,BIM-RPC30545-100UG,BIM-RPC30545-1MG
• Manufacturer: Biomatik Corporation
• Host: Mammal
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Chondroitin sulfate proteoglycan NG2, Melanoma chondroitin sulfate proteoglycan, Melanoma-associated chondroitin sulfate proteoglycan, MCSP

Product Description

Accession Number: Q6UVK1; CSPG4. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1583-2224aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Chondroitin sulfate proteoglycan 4 (CSPG4), partial is a purified Recombinant Protein

Product Properties

• Molecular Weight: 73.2kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >85% by SDS-PAGE
• Sequence: SLKGSQTLTVCPGSVQPLSSQTLRASSSAGTDPQLLLYRVVRGPQLGRLFHAQQDSTGEALVNFTQAEVYAGNILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHLQGPAGASVAGPQTSEAFAITVRDVNERPPQPQ
• Target: Chondroitin sulfate proteoglycan 4 (CSPG4)