Recombinant Human Protein jagged-1 (JAG1), partial, Unconjugated, Mammal

Artikelnummer: BIM-RPC30551
Artikelname: Recombinant Human Protein jagged-1 (JAG1), partial, Unconjugated, Mammal
Artikelnummer: BIM-RPC30551
Hersteller Artikelnummer: RPC30551
Alternativnummer: BIM-RPC30551-20UG,BIM-RPC30551-100UG,BIM-RPC30551-1MG
Hersteller: Biomatik Corporation
Wirt: Mammal
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: CD339
Accession Number: P78504; JAG1. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 185-334aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cardiovascular. Shipping Condition: Ice packs. Short Description: Recombinant Human Protein jagged-1 (JAG1), partial is a purified Recombinant Protein
Molekulargewicht: 46.8kDa
Tag: C-Terminal hFc-Myc-Tagged
Reinheit: >85% by SDS-PAGE
Sequenz: VTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCE
Target-Kategorie: Protein jagged-1 (JAG1)