Recombinant Human Protein jagged-1 (JAG1), partial, Unconjugated, Mammal

Catalog Number: BIM-RPC30551
Article Name: Recombinant Human Protein jagged-1 (JAG1), partial, Unconjugated, Mammal
Biozol Catalog Number: BIM-RPC30551
Supplier Catalog Number: RPC30551
Alternative Catalog Number: BIM-RPC30551-20UG,BIM-RPC30551-100UG,BIM-RPC30551-1MG
Manufacturer: Biomatik Corporation
Host: Mammal
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: CD339
Accession Number: P78504; JAG1. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 185-334aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cardiovascular. Shipping Condition: Ice packs. Short Description: Recombinant Human Protein jagged-1 (JAG1), partial is a purified Recombinant Protein
Molecular Weight: 46.8kDa
Tag: C-Terminal hFc-Myc-Tagged
Purity: >85% by SDS-PAGE
Sequence: VTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCE
Target: Protein jagged-1 (JAG1)