Recombinant Human Serotransferrin (TF) , Active Protein, Unconjugated, Mammal

Artikelnummer: BIM-RPC30555
Artikelname: Recombinant Human Serotransferrin (TF) , Active Protein, Unconjugated, Mammal
Artikelnummer: BIM-RPC30555
Hersteller Artikelnummer: RPC30555
Alternativnummer: BIM-RPC30555-100UG,BIM-RPC30555-1MG
Hersteller: Biomatik Corporation
Wirt: Mammal
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Transferrin, Beta-1 metal-binding globulin, Siderophilin, TF, PRO1400
Accession Number: P02787; TF. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 20-698aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Serotransferrin (TF) , Active Protein is a purified Active Recombinant Protein
Molekulargewicht: 104.1kDa
Tag: C-Terminal hFc-Tagged
Reinheit: >95% by SDS-PAGE
Sequenz: VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVAR
Target-Kategorie: Serotransferrin (TF)